SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022XZL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022XZL0
Domain Number 1 Region: 336-521
Classification Level Classification E-value
Superfamily MIR domain 1.57e-61
Family MIR domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022XZL0
Sequence length 744
Comment (tr|A0A022XZL0|A0A022XZL0_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF75768.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_02724 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MAADDRAFASGTSPNTDLRRRNVPGAEKSSANVPIPSIEVDGKKLKEKSPSFCEILDDLE
VFIAPLIFTALACFTRLWRIGLSDIVTWDEAHFGKFGSYYIKREFYFDVHPPLGKMLIGL
SGFLAGYNGSFEFKSGEKYPPEVNYTFMRIFNAFFGIMCVPLAYYTARELKFRRPAVWLI
TLMVLCENSYATISRFILLDSMLLCFTFTTTLCWARFHRLRHESFSPEWYLWLILTGLSI
GCVCSVKWVGLFCTALVGLYTAEDLWHKFGDLKMPKTVLAHHLGARVFGLIIVPFLVYMF
SFYIHFLVLENSGTGDAQMSSLFQANLRGTNVGKDSPLEVAIGSKITLKNMGYGGGLLHS
HVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGPIAFIGDGDVIRLIHAQTG
RNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDVASRDRSKIRTLTTALRLR
HTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNIESHVNERLPPSEPGTYKS
PFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDNVVKYFLLG
NPFVYWGSTLSLGVFSLLVLWYLLRWQRGYDELSMADIDHIHYSGIYPIVGWFLHYLPFM
IMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIYSVLYVVIIGLFVVFKDIV
FGMEGSNQQWKSLNWLSSWKIANR
Download sequence
Identical sequences A0A022W899 A0A022XZL0 A0A178F7B9 F2STZ8
XP_003233478.1.23396 TERG_06465T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]