SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022Y2I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022Y2I4
Domain Number - Region: 189-258
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00015
Family VPS37 C-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022Y2I4
Sequence length 266
Comment (tr|A0A022Y2I4|A0A022Y2I4_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF77009.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_01734 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MSSFPGSASQTPLQSPRTPPPPPPKQPQLNDGHPPSTPPKEPIHSQTHPGTDITDITAPG
SGPASGRSSAIPTSQPLFEQVPTQPTPPTIEDRWIPEILQDKSTSDLHAMLSNSNLISAI
ADTHPASIHASNNIEKLLATNTSLATHLLGLQSHLSALRASTEALLLQHQSLEVSWRKKQ
TEMDAALDPWSPKALYQRLVGAVAEQEAVCRAVEESFLEEGQRGGGVAAEREVAEWIRRI
RSEGAKLEARREARARWDEGRVGGWR
Download sequence
Identical sequences A0A022WBH5 A0A022Y2I4 F2SXR4
TERG_07356T0 XP_003232511.1.23396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]