SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022Y662 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022Y662
Domain Number 1 Region: 973-1090
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-18
Family cAMP-binding domain 0.0074
Further Details:      
 
Domain Number 2 Region: 765-879
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000159
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022Y662
Sequence length 1101
Comment (tr|A0A022Y662|A0A022Y662_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF78078.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_00918 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MDGGKGKTLPATGRRRSSTFSNLSFLRDAAPAIDRRVSATTTTAGHNSDLLQAPDVSNGA
SLRRRVSASEKTPTRSFYHRTFHGPLDTAQYSSLGVRERTAEIESLALSDAESISHKSLS
GYASDLSTSTGGLFTREGWAGDGVSERLTRSRSRPEAIEERSEPTTPRGSAFPSFVGESA
LTAMLRSSPTSPLKKSTSAPVQSKRDSTIQEPNEDDDETALGHRPVASMPRIIDPEQAPL
IKVHSSSKYGAIPDGPEDFGPQRPDLASLGRWMASKPPAWAKTICNPRTWDKKFIYENGV
HLPVSLLPAVFLGLLLNILDALSYGMILFPLGEPIFAAMGADGIAMFYVSTIISQLVFSC
GGSVFKGGIGAEMIEVVPFFHAMATQILNRVGDDDPRAVYATTILAFSLSAILTGLVFFS
MGACRLGSLIGFFPRHILIGCIGGVGWFLVVTGIEISARLSGNLEYNLKTLEKLFQLDTI
PLWTVPLLLAIGLLVLKRFIRSNLLLCAYFVAIGAGFYIVKFITNVSMSSLREGGWVFYA
PASSQPWYHFYTLYDFSAVHWAALAETVPAMFALTFFGILHVPINVPALGISTGEDHLNV
DRELVSHGISNVFSGFAGSVQNYLVYTNSLLFIASGGNHRLAGIMLAVGTFGVLVIGPGI
VGYIPIMIVGALIYMLGIELLEEALVDTWGKLHRLEYLTVVTIVVTMGAWDFVAGIIVGI
ILACVNFVAQTSQKSAITATYTGQVALSTVRRHPLHARFLREAGKQTFVIKLAGFLFFGT
IVSVEKRIRGLVDAEAFSERPIRFLILDFLYVNGLDFSAAEAFTRLNRILKKKGVHMLVC
GLDITGEVATSLQNVGLFGLDDAVEIFQDLNSALEHCENEALKAIHDHKETSPAGLSPSE
GNLKPLNKAHAQTLAADMAANSPRGYYLHQLASNFLREEAEDTRSGKILHKRLSPAQQQQ
QPLPLLLQTFQGLSIKSAEFWLPVCPYFTRAEFAASSVLYRENDYPGQFYLLESGMLRAE
HATPQGRSYFELIVAGRPCGELSFFGETSRSATVRAERDCVVWALGTKEWETLQVKEPTV
ALELLKVCLKLTAERTESITS
Download sequence
Identical sequences A0A022WEG0 A0A022Y662
TERG_08025T0 XP_003231726.1.23396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]