SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022Y7U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022Y7U0
Domain Number - Region: 29-73
Classification Level Classification E-value
Superfamily Phenylalanine zipper 0.0109
Family Adapter protein APS, dimerisation domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022Y7U0
Sequence length 104
Comment (tr|A0A022Y7U0|A0A022Y7U0_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF78698.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_00298 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MGFFENFSNHADAHNEVMNAPHKASLSHELIAGAAAYEAAKAYEDHVQKNGKPDSHAKAK
EILAGFAGAFTDRMIETKGLDYIDKERVKRQAHEHAQDALGREY
Download sequence
Identical sequences A0A022WGK8 A0A022Y7U0 A0A178EYT9 A0A178FCD8 F2T0V5
TERG_08444T0 XP_003231144.1.23396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]