SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023AYJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023AYJ0
Domain Number 1 Region: 16-73,100-180
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000131
Family MIR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023AYJ0
Sequence length 183
Comment (tr|A0A023AYJ0|A0A023AYJ0_GRENI) Uncharacterized protein {ECO:0000313|EMBL:EZG43345.1} KW=Complete proteome; Reference proteome OX=110365 OS=Gregarina niphandrodes (Septate eugregarine). GN=GNI_176070 OC=Eugregarinorida; Gregarinidae; Gregarina.
Sequence
MRILLGLLSVAYASVVRYGSHISLIHVQSDHLLNSLTKIQWAHGGQIVTGISKGSDNEVV
GSATWIVRAPVKNTATLSAKKLPYFTTQPGVPKESKDVFAAKPAGTPIRCGDEVKMEHAE
SGLILSVLDQKSQITRGLEVVGLSADDRDDTFVVECAQDHWDTKAPVKFRLNGEYLSSDS
KAM
Download sequence
Identical sequences A0A023AYJ0
XP_011133394.1.81794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]