SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023C038 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023C038
Domain Number - Region: 75-126
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00141
Family Sfri0576-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023C038
Sequence length 136
Comment (tr|A0A023C038|A0A023C038_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EZH75564.1} KW=Complete proteome; Reference proteome OX=1317122 OS=Aquimarina atlantica. GN=ATO12_01915 OC=Flavobacteriaceae; Aquimarina.
Sequence
MSDPIKNDKLIKQYDLELGKVFFYENYLIIEVAEGVCFDYQKAKTLSLLTNLHFGDRSFG
YISHRINSYSLEATDYMKIKDVFPNIKAFAAVTYNESQKTSIRIENMFYQEGIVSFENIK
DAIKWVIEKLKNDSNT
Download sequence
Identical sequences A0A023C038
WP_034238142.1.88905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]