SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023CWV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023CWV0
Domain Number 1 Region: 52-142
Classification Level Classification E-value
Superfamily FlaG-like 1.7e-21
Family FlaG-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023CWV0
Sequence length 143
Comment (tr|A0A023CWV0|A0A023CWV0_9LACO) Uncharacterized protein {ECO:0000313|EMBL:KRN06890.1} KW=Complete proteome OX=1423806 OS=Lactobacillus sucicola DSM 21376 = JCM 15457. GN=FD15_GL000450 OC=Lactobacillus.
Sequence
MEIEKVQPVPPTTRVQPIETDNDLDGANLDLRRLAQDLLSDKGEDKPDSEQVAPKPEADS
KSDAAFQAIPQAQLEQAVDEMNKHLLGRDVRMRFRVHKTTGRTYVQLINMKNDDVIKEIP
PTKMLDVIGSIWKQMGIVVDKKG
Download sequence
Identical sequences A0A023CWV0 A0A0A7RM33
WP_051993312.1.27412 WP_051993312.1.29124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]