SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023DKJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023DKJ0
Domain Number - Region: 198-263
Classification Level Classification E-value
Superfamily PH0156-like 0.00222
Family PH0156-like 0.013
Further Details:      
 
Domain Number - Region: 100-172
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00366
Family Apolipoprotein 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023DKJ0
Sequence length 275
Comment (tr|A0A023DKJ0|A0A023DKJ0_9BACI) Uncharacterized protein {ECO:0000313|EMBL:GAJ41785.1} KW=Complete proteome; Reference proteome OX=1220594 OS=Parageobacillus caldoxylosilyticus NBRC 107762. GN=GCA01S_099_00010 OC=Parageobacillus.
Sequence
MQAGMDRAITKILTRESERMSQLEKIFGYQSKVMRINNLDLNLRKKFDLSMYQSELSRAF
NRIGSQLKTTQVHARSIAASLELTKALSNNRISQMYRITDSMQAALNASRQLGLSFTKIY
NSINSPIAELQRTINQTLESYKINLSPTIKALEQWQVQFKELQKINFPKIEELLRNTELT
VIEQDENENWVLDGEIVKKDEIEEVVLGVLERQGVLEKQNTIISMLNNIIERLDKLGKTP
KIKAFVLLIIIPILTNILSGYLQPFFETNQKAFYQ
Download sequence
Identical sequences A0A023DKJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]