SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023EJI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023EJI3
Domain Number - Region: 103-202
Classification Level Classification E-value
Superfamily MIR domain 0.000366
Family MIR domain 0.018
Further Details:      
 
Domain Number - Region: 44-116
Classification Level Classification E-value
Superfamily MIR domain 0.00536
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023EJI3
Sequence length 207
Comment (tr|A0A023EJI3|A0A023EJI3_AEDAL) Putative secreted protein {ECO:0000313|EMBL:JAC09157.1, ECO:0000313|VectorBase:AALF014525-PA} KW=Complete proteome; Reference proteome OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN=109401465 OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MGLSNALFLVLSALLIDTGYSSVSAPFCQCPCENRISISKDWFNCITIYSMKTKGYVTAD
EHYPFLQYYERYVFATNQNKLWGTAKWKVEYKEGNNGTYGLKNLYVKEWLHAGRNDQARD
SFRRYLLTKIRGDPNIPPRDGYWQFIPDPKIGKDVYRIRNTFTGEYLFVDDEQHIQRYDY
NRLYLWRLTGNYQSTDNRHWFKLAKCK
Download sequence
Identical sequences A0A023EJI3
XP_019529575.1.17567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]