SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023EKQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A023EKQ1
Domain Number - Region: 135-231
Classification Level Classification E-value
Superfamily MIR domain 0.000968
Family MIR domain 0.018
Further Details:      
 
Domain Number - Region: 76-149
Classification Level Classification E-value
Superfamily MIR domain 0.0068
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023EKQ1
Sequence length 239
Comment (tr|A0A023EKQ1|A0A023EKQ1_AEDAL) Putative secreted protein {ECO:0000313|EMBL:JAC09751.1} OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MQLNQSLLMDMRFSHGHWQKGAETLEYPVSISKALSTRNNALESALLIDTGYSSVSAPFC
QCPCENRISISKDWFNCITIYSMKTKGYVTADEHYPFLQYYERYVFATNQNKLWGTAKWK
VEYKEGNNGTYGLKNLYVKEWLHAGRNDQARDSFRRYLLTKIRGDPNIPPRDGYWQFIPD
PKIGKDVYRIRNSFTGEYLFVDDEQHYQRYDYNRLYLWRHTGNYQSTDNRHWFKIAKCK
Download sequence
Identical sequences A0A023EKQ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]