SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023F2G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023F2G4
Domain Number 1 Region: 242-428
Classification Level Classification E-value
Superfamily MIR domain 5.58e-62
Family MIR domain 0.0000000505
Further Details:      
 
Domain Number 2 Region: 430-599
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.45e-53
Family IP3 receptor type 1 binding core, domain 2 0.000000322
Further Details:      
 
Domain Number 3 Region: 1107-1134,1171-1279
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.14e-34
Family IP3 receptor type 1 binding core, domain 2 0.0057
Further Details:      
 
Domain Number 4 Region: 110-218
Classification Level Classification E-value
Superfamily MIR domain 0.000000000000017
Family MIR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023F2G4
Sequence length 2724
Comment (tr|A0A023F2G4|A0A023F2G4_TRIIF) Putative inositol 145-trisphosphate receptor {ECO:0000313|EMBL:JAC15485.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
MTELIGSASFLHLGDIVSLFAEGNVCGFLSTLGLVDDRTVVCPEAGDLTNPPKKFRDCLF
KMCPMNRYSAQKQFWKAAKQNSNSTSTTDAVLLKRLHHAAEIEKKQNESENKKLLGMVVQ
YGSVVQLLHLKSNKYLTVNKRLPALLEKNAMRVYLDANGNEGSWFYILPYYKLRSTGDNV
VVGDKVIMNPVNAGQQVLHVSANYDLSDNPGSKEVNVVNTNTPWKVNLFMEHQENQEEIL
KGGDVIRLFHAEQEKFLTMDEYKKKQHVFLRTTGRTSATAATSSKALWEVEVVQHDPCRG
GAGHWNCLFRFKHLATGHYLAAEVDDDTTMDQMRSKLRDTHGGPVYHLISVPHTNEISSL
FELDPTTLTRGDSLVPQSSYVRLHHLCTNTWVHSTSIPIDKDEEKPVMSKVGCAPVKEDK
EAFALIPVSPTEVRDLDFANDACKVLAANSTKLEKGTISSNERRAVTALLQDIVYFIAGL
ENDQNKSEALELVVTNPNRDRQKLLREQYILKQLFKILQAPFMESTAGEGPFLRIEELND
PRHAPYKYMFRLCYRILRLSQQDYRKNQEYIAKHFGFMQKQIGYDILAEDTITALLHNNR
KLLEKHITAAEIETFVGLVRKNMYNWESRFLDYLSDLCISNKKAIAITQELICKSVLSAK
NSDILIETRMVKQTVEEDATNNSFPENAEVTVLMWDNRQKSSSLIELSQAGRMGDQVSIA
LLDYYRHQLNLFSNMCLNRQYLALNNLSSHLDIDLILKCMSDENVSYELRASFCRLMLHL
HVDRDPQEPVTPVKYARLWSEIPSAMSINDYDTNRTPDPNKEAVRAKFSSTIVFVEDYLC
NVVANMWTFQDQYQNKLTFEVVKLARELIYFGFYSFSDLLRLTKTLLSILDCVSENDINR
KIPTGEIHSEGGVLRSIGDMGAVVTGLTLATGISRQGVSNQSTHKTSTLNKKEYPLVMDT
KLKIIEILQFILDVRLDYRISCLLSIFKREFDGTDKIGIDSIPIGQKPIDLELIGTQAEG
IFGSCGDCEALDLDGHGGRTFLRVLLHLTMHDYPPLVSGALHLLFRHFSQRQEVLQAFKQ
VQLLVSDSDVESYKQIKSDLDVLRQSVEKSELWVYKCKSDDTTGNGSLGLGGVGNVGGKD
KKDDGHKTSLGDAGKQLSAADLDIGQTSLDHVNEYTNIQQILQRMNALCVTNAGKPRKHE
QRLLRNVGVHTVVLDLLQVPYDHKEDTKMNQLMSLAHQFLHNFCLGNQQNQVLLHKHLDL
FLNPGILEAETICSIFRDNYTLCNEVNEKVIQHFIHCIETHGRHVQYLKFFQTIVKAENQ
FIRKCQDMVMQELVNAGEDVLIFYNDKASFAQFVAMMLSDRHRMDESSPLRYHIELVKLL
ACCTMGKNVYTEIKCHSLLPLDDIVAMVSHPDCIPEVKEAYTNFLNHCYIDTEVEMKEIY
TSHHMWSLFEKSFIVDMGVVANVTHDRRHADTAMENYVTTTVMAIITTFFSSPFSDQSTT
VQTRQPIFVQLLHSAFRVSQCTWLNATQQFNVENCIRTLSEVAKNRSIAIPSDLENQVAS
MFTKSSLLSRQTSKWLQATKTPKIERSQSQLMRLDRSIIEGLQDIVLLLEDQLKPLVQAE
VSLLVDILYSPELLFPIGTEARKRCESGGFIRRLIKHTEKLLEEKEEKLCVKVLRTLREM
MAIGCEYGEKGDALRTHLLNRYFSKQFVQKKETNETETVTPNQSTILTHGPGGKLLSRAG
RTLHDVQCHLDREGASDLVVELVIKSVHSPSIFGEAVELGTALLEGGNPIIQKSMYNKLL
GGDLSQAFFKVFYDKMRDSQQEIKSTVTVNTSDMAAKAHEDKEQNKELDKLSKRKGKANG
MVITEEIREELNQAAMATSQAYIGTKALIPGEEGMPLLNNSSGSCALEDMLAEKLERSRD
KDDEQLSEKVLVMQPILRFLQLLCENHNRYLQNTLRHQNNKTNYNLVSETLMFLDCICGS
TTGGLGLLGLYINEYNVALINQTLETLTEYCQGPCHDNQNCIATHESNGLDIVTALILNE
INPLGKTRMDLVLELKNNASKLLLAIMESRGDSENAERILYNMNPKQLVDVACRAFHQEN
LDDSLDAEDSATETDDGVSPKEVGHNIYILCHQLAQHNKDLAELLKPSELNVDPKINQAL
EYYASHTAQIEIVRHDRTLEQIVFPIPEICEYITHETKVKILHTAERDDQGSKVSDFFER
TDDMFNEMKWQKKLRGQPALFWVSSYMSLWSNVLFNCAVLINLIVAFFYPFTHTIPKLGP
HLSGLIWAVMLISAAIVITVPRESGIRTLVVSIILAMIFSAGPEPTLWLLGTLTVLLKGI
HLISIMGNQGTFTKSIRQIISDAEILYHLSYVMFCVFGLFLHPFFYSVLLLDVVYREETL
LNVIKSVTRNGRSIILTAVLALILVYMFSIIGFMFFKDDFLVHVDKEYLPALSTETFDEA
CPADNSCKYSTNSHKYTAINADLNVNDNEAKERACDSLIMCIVTTLNQGLRNGGGIGDIL
RAPSSQEPLFVARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKELILKNTCFI
CGLNRSAFDNKTVSFEEHIKCEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMIKDRNLD
WFPRLRAMSLSADESEGEQIELRSLQAQLETTQLLVKTLSHQLTQLKDQMTEQRKQKQRI
GLLNSTSSFLHHRAEISDSILYRS
Download sequence
Identical sequences A0A023F2G4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]