SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023F7Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023F7Z4
Domain Number 1 Region: 11-198
Classification Level Classification E-value
Superfamily ITPase-like 6.54e-55
Family Maf-like 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023F7Z4
Sequence length 243
Comment (tr|A0A023F7Z4|A0A023F7Z4_TRIIF) Putative nucleic acid-binding protein asmtl {ECO:0000313|EMBL:JAC17375.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
MLEPIKHALDFQRIVLASVSPRRSEILHNIGLHFEIMPSLFEENLDPRSFPSIKEYAVET
AYRKVLDVAERMTRDANQPDIIIGADTVVVLDGKIYGKPGSMRTAQKYLETLSGRQHAVH
TGVAIRTPNATVKFHETTLVTMAYLSEVVIDAYLRTKEPLDKAGAYAIQGFGASLIEKID
GDFYNVMGLPVHSFCKHLLWLFEDRAKKMELTRTIGAKAADEVLSKKIAITAPKTAEKKK
SPK
Download sequence
Identical sequences A0A023F7Z4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]