SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FHX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FHX9
Domain Number 1 Region: 80-202
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.3e-41
Family Transducin (alpha subunit), insertion domain 0.00000348
Further Details:      
 
Domain Number 2 Region: 34-84
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000421
Family G proteins 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023FHX9
Sequence length 203
Comment (tr|A0A023FHX9|A0A023FHX9_9ACAR) Putative g-protein alpha subunit small g protein superfamily {ECO:0000313|EMBL:JAC20720.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
NIAPPVRPSNAAAAGSVDMGCAVSTAADKEAAERSKKIDRDLRADGERQAREVKLLLLGA
GESGKSTIVKQMKIIHESGYTSDECKLYRPVVHSNTIQSLLAIIRAMGQLKIDFRDPSRA
DDARQFFTVAGATSSQECEISPELAALMKRLWQDPGVQHCFARSREYQLNDSASYYLNAL
DRISQPSYTPTQQDVLRTRVKTT
Download sequence
Identical sequences A0A023FHX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]