SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FTE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FTE6
Domain Number 1 Region: 32-96
Classification Level Classification E-value
Superfamily BPTI-like 0.00000511
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.015
Further Details:      
 
Domain Number 2 Region: 105-155
Classification Level Classification E-value
Superfamily BPTI-like 0.000049
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023FTE6
Sequence length 164
Comment (tr|A0A023FTE6|A0A023FTE6_9ACAR) Putative kunitz domain protein {ECO:0000313|EMBL:JAC23948.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
MKFLAIILLSCWSGPALGSGGAMIEQRTFNWPLRPDCFRQPDHSAKSCGRQVFERRFYYD
TNKQKCTLFIRPKCDDDEKYGKFFKRRRPCIKKCMQKSPCLKKTWKNDTGSLDGFAYYPP
LDLCTSIKYEKSAKLWPSNNIFSTAEECQTNCAPADPIYDLLAQ
Download sequence
Identical sequences A0A023FTE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]