SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023FUF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FUF4
Domain Number 1 Region: 45-216
Classification Level Classification E-value
Superfamily MIR domain 1.57e-53
Family MIR domain 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023FUF4
Sequence length 233
Comment (tr|A0A023FUF4|A0A023FUF4_9ACAR) Putative secreted stromal cell-derived factor 2 {ECO:0000313|EMBL:JAC24300.1} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
MATRRWMPAAFCAFYAMCSVCWCKISLLFLILVHLGTLACADLQYVTCGSVLKLENLQNQ
VRLHSHDIKYGSGSGQQSVTGTLDREDNNSHWVVKGKREKACQRGDPIPCGSLVRLEHLV
TRKNLHSHHFVSPLSNNQEISAFGDGGEGDTGDNWTVVCSSDFWERGASVRFKHIDTDAW
LCSSGQTYGRPIGGQVEICGLSYPDSSCHWKTAEGIYIKPTADMTAGRLHDHS
Download sequence
Identical sequences A0A023FUF4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]