SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023FV22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FV22
Domain Number 1 Region: 6-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-96
Family Capz beta-1 subunit 0.000000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023FV22
Sequence length 279
Comment (tr|A0A023FV22|A0A023FV22_9ACAR) Putative f-actin capping protein beta subunit {ECO:0000313|EMBL:JAC25691.1} OX=251391 OS=Amblyomma parvum. GN= OC=Amblyomma.
Sequence
FTMTTDQQLDSALDLMRRLPPQKIEKNLSDLIDLVPGLCEELLSSVDQPLKIATDKKCGK
DYLLCDYNRDGDSYRSPWSNNYEPPLEDGALPSERLRKLEVDANQAFDQYREMYFEGGVS
SVYLWDLDHGFAGVVLIKKGGDGSKKIMGSWDSIHVVEVQEKSSGRNAHYKLTSTAMLWL
QTKKPGSGTMNLGGSLTRQMEQDSAVSEAVPHIANIGKMVEDMENKIRTTLNEIYFGKTK
DIVNGLRSLQPLQDRKQQEALRNDLAQALRNRQQAKQDS
Download sequence
Identical sequences A0A023FV22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]