SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FWL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FWL2
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 4.97e-49
Family Arp2/3 complex 16 kDa subunit ARPC5 0.0000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023FWL2
Sequence length 152
Comment (tr|A0A023FWL2|A0A023FWL2_9ACAR) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} OX=251391 OS=Amblyomma parvum. GN= OC=Amblyomma.
Sequence
MSKNTESSAFRKIDIDQYNEDNYKEEEGLDAQSPPAGPDEQEVNHLLNQGKTVDALKIIL
KTAPIGSKCQDVKDAASALAMRVLLAVKASEMEQAVGSLDRESVDVLMKYIYRGFESPSE
GSSGHLLAWHEKAYAAGGIGSIVRVMTDRKRV
Download sequence
Identical sequences A0A023FWL2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]