SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023G2U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023G2U0
Domain Number 1 Region: 86-141
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000523
Family ATI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023G2U0
Sequence length 195
Comment (tr|A0A023G2U0|A0A023G2U0_9ACAR) Putative tick til 10 {ECO:0000313|EMBL:JAC28084.1} OX=251400 OS=Amblyomma triste. GN= OC=Amblyomma.
Sequence
MATLAILAFGTACVLILQASAEHQRPHGIPGHPGNVLLPLDLPGDVSLPGHYPGSWPGEW
PGSWEPGQWPGQFPGPWPGRRLCRRKHEVYKRCVSGSCAEATCRKRHVGPFCTLDCQSGC
FCKKGYHRNRHGQCVRWRECKHEGWPRPPVYPLPWDYPSQNRGTVNQDGSRNFTVQQLLN
CRLRLPNKTLRNKPM
Download sequence
Identical sequences A0A023G2U0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]