SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023HBA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023HBA3
Domain Number 1 Region: 31-197,259-279
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 1.83e-81
Family Cytochrome f, large domain 0.000000524
Further Details:      
 
Domain Number 2 Region: 276-314
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000106
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00085
Further Details:      
 
Domain Number 3 Region: 199-260
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.0000000000000011
Family Cytochrome f, small domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023HBA3
Sequence length 314
Comment (tr|A0A023HBA3|A0A023HBA3_9STRA) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=163516 OS=Leptocylindrus danicus. GN=petA OC=Leptocylindrus.
Sequence
MATNKFFKSILLNLTIAISLFGFCIQNSEAYPVFAQQGYANPRAANGKLACANCHLNQKA
IEIEAPQAVLPNSVFEIEVKVPYDVSRQQLSAVGKKADLNVGGIVILPKGFKLATGSQVS
KEIKAKNKGVFISPYSTDFDNILVVGPIAGKTHQELIFPVVAPDPEKNSDVKYLTYPLYA
GGNRGRGQVYPTGEKSNINAFGAVQAGQISDITVTEKGESQISINDSTGKTTTQTIPTGL
QLTVKAGDVVKVDQPLNIDPNVGGFGQEETEIVLQNPLRIIGYLAFCFCVLLTQVFLIIK
KKQFEKVQAAELNF
Download sequence
Identical sequences A0A023HBA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]