SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023HRI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023HRI3
Domain Number 1 Region: 27-193
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000000000000445
Family Galactose oxidase, central domain 0.05
Further Details:      
 
Domain Number 2 Region: 310-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000345
Family PHD domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023HRI3
Sequence length 328
Comment (tr|A0A023HRI3|A0A023HRI3_9TELE) Recombination activating protein 2 {ECO:0000313|EMBL:AGQ17978.1} OX=219678 OS=Rhynchocypris percnurus (lake minnow). GN=RAG2 OC=Cyprinidae; Rhynchocypris.
Sequence
SLYMLSVDSRGCNRKVTLQCQEKELVGDVPSARYGHTLSVIHSRGKTACVLFGGRSYMPP
SERTTENWNSVVDCPPQVFLIDLEFGCSSAHILPELTDGQSFHVALAREDCVYFLGGHIL
SSDCRPPRLIRLRVELLLGSPVITCTVLQEGLSITSAITSPVGYHEYIIFGGYQSETQKR
MECTYIGLDDVGVHMEPREPPQWTSEISHSRTWFGGSLGKGSALFAVPSEGNPTPPDAYH
FYQVNFQKEPDGEASTQGCSQESTDFEDSAPLEDSEELYFGREPHELEDSSDGEGATYNE
EDEEDESQTGYWVKCCLSCQVDPNTWEP
Download sequence
Identical sequences A0A023HRI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]