SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023JH25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023JH25
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-27
Family Duffy binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023JH25
Sequence length 121
Comment (tr|A0A023JH25|A0A023JH25_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AHI95167.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
ARSFADIGDIIRGKDLFLGHQQRKRKLEENLRNIFKNIHDHLTDHKAKRYYNDDTDNNFY
QLREDWWTANRDQVWKALTCSADDSVDYFIQSESNKKLFSNSKCGHDENKVLTNLDYVPQ
Y
Download sequence
Identical sequences A0A023JH25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]