SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023JI28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023JI28
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-24
Family Duffy binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023JI28
Sequence length 125
Comment (tr|A0A023JI28|A0A023JI28_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AHI95086.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
ARSFADIGDIIRGKDLYLRYNRKDKTDKLQEQLKKYFQKIYEQLVKKKGSEAKDRYKGDD
PDFFKLREDWWDANRKMVWLAITCGAAGSQYFRQTCGINHSWTGEDCRCTLHDVPTYLDY
VPQYL
Download sequence
Identical sequences A0A023JI28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]