SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023P9M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023P9M8
Domain Number 1 Region: 438-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.53e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023P9M8
Sequence length 587
Comment (tr|A0A023P9M8|A0A023P9M8_9BACI) Sulfate transporter {ECO:0000313|EMBL:AHX19428.1} KW=Complete proteome OX=1330043 OS=Bacillus bombysepticus str. Wang. GN=CY96_15990 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRKLLTGRFEGYSLAHFQKDLLSGMIVGVVAIPLAMSFAIASGVKPEYGIYTTCIAGILI
SLFGGSKYQIGGPTGAFVPILLGVVITYGYENLLLAGLLAGIILCLMGIFKLGSLIKFIP
RPVTIGFTSGIAVIIFTGQIASFLGLTGIKKHEEFLANLKELFTHISTTNFYSVITALIC
FFVILITPKILPKVPGSLVGVVISTVIATVFFSGYVPTIGTAYGTIPNTLPHFDIPEITL
ERIKQLIGPAFVIAMLGGIESLLSAVVADGMTNSKHNSNKELIGQGIANIVTPLFGGIPA
TGAIARTATNIKSGAVSPMAGVIHGGFVLFTLLLLAPYASHIPLASMAPILMVVAWNMSE
QKHFYHILKMKTGDSLVLLVTFLLTVFTSLTTAVEIGLILAIILFTKRMSNMLVISKVLP
DHTKRNEKLLPHVVNKAHDCPQISIYTIEGPLFFGAAQTFEQNILATIHYKPNVLILRMG
KVPFIDTTGESYFRNIVQHFKKQGGVLLISGIQSELKANLDKNGLYAEIGEENFFNHTGE
AINCALGHLNTKKCIGCKHFAFHECTGLSQQSQEINTIKNKENALDF
Download sequence
Identical sequences A0A023P9M8 A0A2A8M7X2
WP_044584714.1.51681 WP_044584714.1.869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]