SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023WP22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023WP22
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 2.09e-23
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0018
Further Details:      
 
Domain Number 2 Region: 93-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000127
Family Prokaryotic DksA/TraR C4-type zinc finger 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023WP22
Sequence length 134
Comment (tr|A0A023WP22|A0A023WP22_PSEST) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome OX=316 OS=Pseudomonas stutzeri (Pseudomonas perfectomarina). GN=UIB01_03225 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTEAELLAQPAAAYMNAEQQTFFRDLLLRQRQELQSRIAEEFDALREVEPSSDPADIGSA
EEQRQWQLRVLEREKKLLDKIDDALDAIARGEYGWCAETGDPIGLQRLLLRPTTTLSIEA
KQRQEQREKHQRSA
Download sequence
Identical sequences A0A023WP22
WP_038656797.1.50587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]