SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023XNT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023XNT5
Domain Number 1 Region: 180-453
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.99e-58
Family PFOR Pyr module 0.013
Further Details:      
 
Domain Number 2 Region: 2-199
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000000000275
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.019
Further Details:      
 
Domain Number 3 Region: 471-572
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000361
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A023XNT5
Sequence length 585
Comment (tr|A0A023XNT5|A0A023XNT5_BRAJP) Ferredoxin oxidoreductase alpha subunit {ECO:0000313|EMBL:AHY53861.1} KW=Complete proteome OX=476282 OS=Bradyrhizobium japonicum SEMIA 5079. GN=BJS_01242 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MFARAILRHGVPVSPRNIFPSNIQGLPTWYEVRVTEDGHLGARGGVDMMVAMNPQTWDKD
VAGIEPGGYLFYDSTKPMPSTKFRDDITVIGVPLTAITNSTYTDPRQRQLFKNIIYLGSL
SALLDMDPKLIEQLIGEQYKGKEKLLSSNVHALHLGRDWALQNLKCPIGLRVKKTDKVGD
RIFIEGNSAAALGAVYGGATVCAWYPITPSSSVAEAFTAHCKKYRHDPETGKAKYAIVQG
EDELASIGIVIGASWNGARAFTATSGPGISLMTEFIGLSYFAEIPAVIMNIQRAGPSTGM
PTRTQQCDIIACAYASHGDTKHVLLFPEDPAEAFEFAAAAFDLAERLQTTIFLMLDLDIG
MNHRLCRPLKWDDARQYDRGKVMTTEMLEEGRDFGRYLDVDGDGIPYRTYPGTHPTKGSY
FTRGTSRDRYARYSEEGSVYADNMQRLVRKFETAQDLVPRPLQANAERPTKYGVIYFGST
SPAMDEAIGLLEARGHQLDRLRIRAFPFHSSVASFLAEHDFVYVVEQNRDAQLRQLIVNE
NGIDPVRLVPIVHYDGTPITARFIAKAIGDHQDHLKVTPLRKAVS
Download sequence
Identical sequences A0A023XNT5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]