SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023YW11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023YW11
Domain Number 1 Region: 452-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000942
Family Anti-sigma factor antagonist SpoIIaa 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023YW11
Sequence length 559
Comment (tr|A0A023YW11|A0A023YW11_ECOLX) Putative sulfate permease {ECO:0000313|EMBL:AHY70078.1} KW=Complete proteome OX=1248823 OS=Escherichia coli O145:H28 str. RM12581. GN=ECRM12581_7740 OC=Enterobacteriaceae; Escherichia.
Sequence
MNKIFSSHVMPFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQY
GLYTAAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMG
LARFGRLIEYIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPT
INVGDAAIGIVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYV
LADGSQGNGIPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVL
DGMTGTKHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILV
ILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVL
FDMVIAISVGIVLASLLFMRRIARMTRLAPVVVDVPDDVLVLRVVGPLFFAAAEGLFTDL
ESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQ
PIPGRLAFFPNRRAAMADL
Download sequence
Identical sequences A0A023YW11 A0A025C7E9
WP_001033355.1.100803 WP_001033355.1.10524 WP_001033355.1.10824 WP_001033355.1.11052 WP_001033355.1.11542 WP_001033355.1.12766 WP_001033355.1.15453 WP_001033355.1.16270 WP_001033355.1.18275 WP_001033355.1.20609 WP_001033355.1.23855 WP_001033355.1.24968 WP_001033355.1.28318 WP_001033355.1.3233 WP_001033355.1.36207 WP_001033355.1.37548 WP_001033355.1.38751 WP_001033355.1.41488 WP_001033355.1.43898 WP_001033355.1.47197 WP_001033355.1.49275 WP_001033355.1.52945 WP_001033355.1.58340 WP_001033355.1.59858 WP_001033355.1.61097 WP_001033355.1.66796 WP_001033355.1.67451 WP_001033355.1.68012 WP_001033355.1.70200 WP_001033355.1.70705 WP_001033355.1.71695 WP_001033355.1.73230 WP_001033355.1.7597 WP_001033355.1.79866 WP_001033355.1.80402 WP_001033355.1.81219 WP_001033355.1.84797 WP_001033355.1.90690 WP_001033355.1.93112 WP_001033355.1.9327 WP_001033355.1.95275 WP_001033355.1.97351 WP_001033355.1.98202 WP_001033355.1.98404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]