SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024CAK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024CAK0
Domain Number 1 Region: 20-83
Classification Level Classification E-value
Superfamily XseB-like 0.000000000392
Family XseB-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024CAK0
Sequence length 86
Comment (tr|A0A024CAK0|A0A024CAK0_HELPX) Exodeoxyribonuclease 7 small subunit {ECO:0000256|SAAS:SAAS00387558} KW=Complete proteome OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=EG63_07285 OC=Helicobacteraceae; Helicobacter.
Sequence
MQDELFETEKAPQKNTKNAKNAPKKSFEEHVHSLERAIDCLNDPNLSLKDGMDLYKTAMQ
ELVLAQKLLENAYLEYEKLQTPDKKA
Download sequence
Identical sequences A0A024CAK0
WP_038418186.1.3435 WP_038418186.1.60286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]