SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024P574 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024P574
Domain Number 1 Region: 22-125
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.39e-18
Family Heme-binding PAS domain 0.038
Further Details:      
 
Domain Number 2 Region: 140-247
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024P574
Sequence length 254
Comment (tr|A0A024P574|A0A024P574_9BACI) Uncharacterized protein {ECO:0000313|EMBL:CDQ23796.1} KW=Complete proteome; Reference proteome OX=195088 OS=Halobacillus karajensis. GN=BN983_02047 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Halobacillus.
Sequence
MSDKISDIDYREVTEYSLDPLIIHTDYKIIYINQAAEEFFKTEKEEVIGGSPLDIFKETS
KGAIRKRIQSAYGHPAEVIEETIYRADGTTVEVELYCHPIVVENKKAIQTYIRDITDRKE
IEKKQKEMIKQINELSATVVPILNEIAVLPLVGKFDEEKAQLLLEIVPVKVQKQDISYLI
IDFSGIYTLDSVVIDNLFRINSVLSLLGVRPIITGLRPELSMAATNLHTDLSSIPTMATV
KDALSYLGVNLKVQ
Download sequence
Identical sequences A0A024P574
WP_035508164.1.21052 WP_035508164.1.39234 WP_035508164.1.72836 WP_035508164.1.82412 WP_035508164.1.89810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]