SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024QL28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024QL28
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.73e-26
Family Anti-sigma factor antagonist SpoIIaa 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024QL28
Sequence length 113
Comment (tr|A0A024QL28|A0A024QL28_MYCNE) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=1795 OS=Mycobacterium neoaurum. GN=BN1047_00808 OC=Mycobacterium.
Sequence
MSNFPVNSLESGVAVVVPTGRVNMVAAPALRRQLHSLVEDGHTRVVVDLSGVDFIDSSGL
GALISGLKVARQAGGDLRIAAPSRQVTSVLELTNLNRVLRAHAEAASAFDDHA
Download sequence
Identical sequences A0A024QL28
WP_030135711.1.2472 WP_030135711.1.41034 WP_030135711.1.52827 WP_030135711.1.97796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]