SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024RDA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024RDA4
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 8.39e-21
Family Interleukin 8-like chemokines 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024RDA4
Sequence length 98
Comment (tr|A0A024RDA4|A0A024RDA4_HUMAN) C-X-C motif chemokine {ECO:0000256|RuleBase:RU361149} OX=9606 OS=Homo sapiens (Human). GN=hCG_23842 OC=Catarrhini; Hominidae; Homo.
Sequence
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Download sequence
Identical sequences A0A024RDA4 G1R9F6 P02778
gi|149999382|ref|NP_001556.2| 9606.ENSP00000305651 ENSP00000305651 ENSP00000305651 ENSNLEP00000009846 ENSP00000305651 NP_001556.2.87134 NP_001556.2.92137 XP_003265820.1.23891 ENSNLEP00000009846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]