SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024S1U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024S1U8
Domain Number 1 Region: 664-888
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.89e-68
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00092
Further Details:      
 
Domain Number 2 Region: 890-1050
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.8e-37
Family NADPH-cytochrome p450 reductase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 408-650
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.14e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00075
Further Details:      
 
Domain Number 4 Region: 261-419
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.84e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024S1U8
Sequence length 1050
Comment (tr|A0A024S1U8|A0A024S1U8_HYPJR) Uncharacterized protein {ECO:0000313|EMBL:ETR98395.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_138931 OC=Trichoderma.
Sequence
MSSKVEESSTLPFGKQVPLSDISSPTYVTAQLLVQQIAYKLSDKIFSYSPPTFGLDASAR
QWAADESKNVHGYAPDVLPLQTRTGAGALALGYIFSPDFDVSKRHIPQTLLAPSGSLQNL
RGTLDQLSLLYNLSSPFVAHVAAADYSAANGLVSDYEVALRLAEDLGLGLVASSSVYETQ
HMSIFSTLLASVVPTLHIYDGIRLPRETLRVVDALSETGVANVYNTLVKEAGKLNQHLDT
AGKVLELLKLFNDELGTVYQPFEYHGHETPDVVLVALGSVETQVAKETIKKIAGDGAKVG
VINVRVYRPFIEEAFLKAIPASARTIAVLGQVNSEAAVTDEATQSALYGDVLTAVTFAGK
FEQQPEVLDIKYTPAQSLTPQGLVNILHKIFGNDDEAKPLPSLLIKPQEFTFWDLDNSVS
AKSAAALGKFLAQEDTNNVQVFETYDNFTQGGIVRTDVRASKYELEAPYSVTAAETVVVG
DEKILKDVDVLANVVPGGKLLIKLPNFNKADVEKRLPAAVRKTIREKGLRVFVLDPAVSP
AFEKDASVAKLLLELAFMQVALPESRPEDFAALVEAQPHLQEARSALDQVLSELEVPDSW
AEVEPDFVHPSLPTDVQTNAFVPFEKEEAEEAWKLQDWQVAAKGLVFKEAYGTQTTLRPE
LSVKTSTVRVKENRRLTPSDYDRNIFHIEFDLGDSGLTYKIGEALGIHAENDEEQVNAFI
EFYGLNPAELVQVPSREDPEALEVRTVFQALTQNVDIFGKPPKRFYEALSEFATDETEKK
KLAALGGNDGAAEFKRRSEVDTVTYVDILEEFSSARPSFHDLIKIVSPLKRREYSIASAQ
AVTPNSVSLMIVVVDWVDTKGRTRVGQATRYLSRLQPGAAVTVSVKPSVMKLPTKDTAPL
IMAGLGTGLAPFRAFVQYRAMQKAQGKEIGSILLYLGSRHQREEYLYGEEWEAYLAAGVV
TLIGSAFSRDQPKKIYIQDRMRQTLDSIAQAYIKEGGSFYLCGPTWPVPDVTAVLKEAIA
AEAQASGKKVDPTKEIERLKEEGRYVLEVY
Download sequence
Identical sequences A0A024S1U8 G0RU96
XP_006968828.1.9351 jgi|Trire2|81576|estExt_GeneWisePlus.C_260006 51453.JGI81576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]