SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024S221 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024S221
Domain Number 1 Region: 5-142
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.57e-27
Family Ricin B-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024S221
Sequence length 144
Comment (tr|A0A024S221|A0A024S221_HYPJR) Ricin B-like lectin {ECO:0000313|EMBL:ETR99374.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_86525 OC=Trichoderma.
Sequence
MSFNEGTYFITTALSSHKAVDLDSSEATGRIIVYEGHDGKNQQWRVSKITHDEWSIQSVA
TDTYITASSGDDAAVHGSKLLPECNSVARWKIVKANKGDNYHIYSVAHPRKVLDVTGSKQ
ENSTPIIAYNYHGGANQQFIFSEV
Download sequence
Identical sequences A0A024S221 G0RRQ3
jgi|Trire2|72071|kg2.C_scaffold_19000041 XP_006967930.1.9351 51453.JGI72071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]