SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024S7A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024S7A7
Domain Number 1 Region: 4-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-84
Family Capz beta-1 subunit 0.0000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024S7A7
Sequence length 283
Comment (tr|A0A024S7A7|A0A024S7A7_HYPJR) F-actin-capping protein subunit beta {ECO:0000313|EMBL:ETS01240.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_111819 OC=Trichoderma.
Sequence
MAADPFDSALDLLRRLNPKHTSEHLNAIISLAPDLTEDLLSSVDQPLTVKRCKQTGRDYL
LCDYNRDGDSYRSPWSNQFDPPLDEGGVGGVGPGGSEGAGEGAIPNERVRKMEVKANEAF
DIYRELYYEGGVSSVYLWNLDDGFAGVVLVKKAATPGTNTEGVWDSIHVFEAIERGRTTH
YKLTSTVILSLSTNVEGTVGDMDLSGNMTRQVEQDLPVENDDSHIANVGRLVEDMELKMR
NLLQDVYFGKAKDVVGDLRSVGSLSEGARERETQRELIGSMKR
Download sequence
Identical sequences A0A024S7A7 G0RME8
jgi|Trire2|78961|estExt_GeneWisePlus.C_120171 51453.JGI78961 XP_006966281.1.9351 jgi|Trilo1|360281|fgenesh1_kg.4_#_204_#_Locus793v1rpkm191.08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]