SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024S9Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024S9Y1
Domain Number 1 Region: 333-518
Classification Level Classification E-value
Superfamily MIR domain 8.11e-61
Family MIR domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024S9Y1
Sequence length 740
Comment (tr|A0A024S9Y1|A0A024S9Y1_HYPJR) Family 39 glycosyltransferase {ECO:0000313|EMBL:ETS02170.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_79287 OC=Trichoderma.
Sequence
MAADKAALASGADLGDGLRKRQAASQAVPSFIPAQTEDTKKLAKKDKTFVQVLADWESVL
APLIFTAVAIFTRLYKIGLSNIVTWDEAHFGKFGSYYIKHEYYFDVHPPLGKMLVGLSGV
LAGYNGSFEFKSGEQYPEDVNYTFMRAFNAAFGIACIPMAYFTAKELKLTRPAVWFVTLM
VLCENSYTTISRFILLDSMLLCGTFATTLCWAKFHNQRHNSFEPEWFFWLFMTGLSIGCV
CSVKLVGLFVTALVGLYTIEDLWRKYGDRKMPIPVLAAHFSARVVGLIIVPFLIYMLSFA
LHFAILDHSGPGDAQMSSLFQANLKGTEVGKNSPLEIALGSRATIKNMGYGGGLLHSHVQ
TYPEGSGQQQVTCYHHKDANNDWFFYPNRHEPDYDPEGELRFIGDGSVIRLIHAQTGRNL
HSHDIDAPITKSHREVSSYGNLTVGDEKDHWKIEVVRDAASRDRSRIRTLTTAFRLKHTV
LGCYLRAGNVNLPQWGFKQIEVTCDKQNNPRDTYTHWNVEAHWNDRLPPSDPGVYKSPFI
HDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHVGLRMCSWDDNIVKYFLLGNPF
VYWASTASLGAVALVIAWYVVRWQRGFKELSNSEVDQIHYAGIYPVIGWFLHYLPFVIMA
RVTYVHHYYPALYFAILSLGFLVDWVLRNRAAVVQGVAYGILYTVVIGLYILFMPICWGM
TGSSKQYSYLKWFDNWRISD
Download sequence
Identical sequences A0A024S9Y1 G0RL73
51453.JGI22527 jgi|Trire2|22527|estExt_fgenesh1_pm.C_110097 XP_006965922.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]