SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024SGT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024SGT4
Domain Number 1 Region: 336-522
Classification Level Classification E-value
Superfamily MIR domain 5.36e-54
Family MIR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024SGT4
Sequence length 773
Comment (tr|A0A024SGT4|A0A024SGT4_HYPJR) Mannosyltransferase PMTI {ECO:0000313|EMBL:ETS04493.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_33306 OC=Trichoderma.
Sequence
MARSPTPQGSLRQRNVASKQAPVESAFVPEVELDKLSKAALSSRRNIQRGELEHKLALTL
VTILGFVTRFWGISHPDEVVFDEVHFGKFASYYLQRTYFFDVHPPFAKLLFAFVGWLVGY
DGHFHFDNIGDSYVANKVPYVAFRALPAFLGALTVSVTYLIMWESGYSVPACLVATGLIL
LDNAHIGQTRLILLDATLVLAMACSLLFYIKFYKLRHEPFSRKWWKWLILTGFALSCDIS
TKYVGLFAFVTIGSAVIIDLWDLLDIKRRYGAISMPEFGKHFAARAFGLIILPFLFYLFW
FQVHFSVLTRSGPGDDFMTPEFQETLSDNVMLASAVDIQYYDTITIRHKETKAYLHSHTD
TYPLRYDDGRISSQGQQVTGYPHNDTNNYWQILPADNDQKLGRNVKNQDLVRLRHIVTDK
ILLSHDVASPYYPTNQEFTCVTPEEAFGERQNDTLFEIRIEGGKTGQDFKTVASHFKLIH
FPSKVAMWTHTTPLPEWAYRQQEINGNKQITPSSNVWIAEDIPSLPEDDARRHKEQRKVK
SLPFLRKWFELQRSMFYHNNKLTSSHPYSSQPYHWPFLLRGVSFWTQNDTRQQIYFVGNP
IGWWLASSLLAVFAGIIGADQVSLRRGIDALDHRTRSRLYNSTGFFFLAWATHYFPFFLM
GRQLFLHHYLPAHLASCLVTGSLVEFIFNTDPADEEPSRSKNPKATGPRRHITARERFAG
KSMAGAWIACFVILAAAAASWYFFLPLTYGYPGLSVEEVLRRKWLGYDLHFAK
Download sequence
Identical sequences A0A024SGT4 G0RCC9
XP_006962965.1.9351 jgi|Trire2|75421|estExt_GeneWisePlus.C_30650 51453.JGI75421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]