SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024TC10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024TC10
Domain Number 1 Region: 264-403
Classification Level Classification E-value
Superfamily MIR domain 3.92e-19
Family MIR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024TC10
Sequence length 2655
Comment (tr|A0A024TC10|A0A024TC10_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV91136.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_14148 OC=Aphanomyces.
Sequence
MSDGGSFRVYPDAVGFLEFGMVVSLIANDRSGVIASEGFTACEVHLERTLSTAIVDDATQ
ESHLVECHFKDCLFEIVPKMSYDATLAYEKATAQLHKNDPAPVHGFSNPLSEMRFKSESE
KRLNAAAYTKSHGKHVDYGQGIQLRHVKSGKFLATKPSSFDTCDFVDIGLAPGLPAAHFV
LLPRFKLRRKGEPVQIQDQIVLATDDMRLFVQPSSRFNSARAPLVTASVAHSMPWRVLVY
DSSDRVRSSAEKYHQDDAQGFKAGQCLRLHHLETGSWLAYDATSATLRLDRDCDASDHAT
VVLSPDTLWEVERSRVHEGGAIHWTKHVCLRHVTSGKYLALANTDADQPAMAKAQRAPDT
FAFRPLTHVNLRSAVARDSVVQVQHVASSAFLHAASPPVPLTEDASVSCPVEGVKVPNDE
DAFKLESVPQTEVHDVMLLASYRRMLEQFVVFFDAKAPWPVTMSTEAFFADVLAALEALK
AFGFYDTAADARRHVLLRKHHYMELVTRMLEAPFEPWGGPFSMAYVSLFRADARPTYDPM
QSNISMTLDGLDDGSTDESAVAQPPSSGPFAALSEASLKTIHQIVRAANVLLFRMFSTCE
PRDASTCGRSLSVLMKMLGHGFKASFPLSYLIQQKFHLSREFQSFSKIIRDFLDLIKAHG
KSYRYVQFLVVLCTANGLAVPKIQDKICDLIFVPSEGYRDAILLETRPSHALDVGIPTRR
GIEWKPVKVFYDEYYKANLHTTLAPYFYGLVQLYVALCADRNYKCIEILKDKFPRQCLLA
CVQDRSLARSIRAVLLNLLVVVHVDCDPQKPVASPNYTRIWHDDAIQLPQVDTTKYSADD
RAFFRRLKAVVIDYLARRKGVIVVGVGELARNELTLAMMRTCHKLVDFGMVHDDLQSIVG
HLVDLLDCRTDTIAHDDGVAASAGEVTVPLFENCVHRHKNPFSRQYSEDGKLHLVKPVRR
LSMGTASFAKARIVHDPTTVSRFQASQGNAIVMEIKDCICATLLRIDALRLDYQLSLVLA
YVKTRNRTPHAPNDHVSPLAQALAQRTCHLTCEYSLPVLANRRLDTIFLQTLMYEHPPLV
SKALELLYLEFNQHEQLIKALDQVFLLVDATTVHLYATLQDDVDRLRHLAETTEVWMDLT
SSGDFAASHRACTLLESLQALMQSAEGAAMTRLMSNLDVLQVVVAMVYSGSHYFHDLFPS
QTAVAPASPQKPSTLVHDVLQDQQRAAIRRVYDGCMAFLCAYCAVNVQSVAEYAVMLLDF
VEALPSAQDVLLAIYTHDVCDAIPPDVLVQFIRWSIFFKPAAETRFLAFLSGVAISAHTQ
RSLVNQIAKNPEVVDTQDVMGQGVAGRSYVAAILHLLTTIATTSEARDMCAESFVTVARW
VDLFEQCEADADAFGFVAIKYLDDVLLQHDDCVYKMDDALHVRLFGAVRRFSLCCIRRHV
HALAQLDMRDDKAAMGLSNDVPMIKHVLPMLVTYFPKLNPALLGHEDVDEWLAAWFVWVF
CAVSRATLTDAGVESALHLCMRWLDQLWKPTSDSSSLEQLFDEGCRRSARPFIGLSGIAE
PFVMDFDKPFVELVNDVHAYRVYCASNNPTSAASSPAPPDAVVMPIVPLEDKLPPLHVDI
VRKQSWLPSWGRAKKKRHTSAVVPSNGKSSKSSPRAFNMPSFGAYSGDDCSIVADFVQYV
RDHRQTKSAIRNELSAMMQSIVCLEDALKEEHASHAGVPAVISTFDEVAAKLVSHFQMLK
HARFVKMSVVLLDVFTRTILSIEHDRKRRQMQLQLDHVGLTAVLVDLISHTDDVQVFDRC
VWLGIAMLDGMNARVQERFHALLTQHAACLGKFKLHLDMLLTRTDGTRKPRPVMCFSPKT
TTTRTDEPATKYQSAARQFRFLQLLCEGHYGANQQCMLGDYPGGVNLVDVATAVVVEFHT
NGSWDAMALLRQVFDTITEFCQGPCPEAQLCVANYKLISAVNALLWRDTNDLTVTAVDLV
RQLKASVVVTLLSLVERRVDHEIHRRLVQELNLEAIKANLIVVHDYFAATYHGQYDGNVA
CSRDAFLTMGFNLYILMQHLVEFEPSLLSTLVPADDVAYRTAYAFFDDRCARVEIVWPTT
RDPAARPIAGDLVSIYFPLHPICVCLTDRAKRRLLDDVSRDANRLDDFYDKTHVAMLEMH
HQCTLRGHAWMALLTQHLSQLKLAAFVWSVFLNGLIVVYNELDSRTPFAVQVVGYVHVAL
CAAIVAGHCINDVPLLLVAHRHNDHRTLRFDSSVEDTLDDVEAKVRAVSDDRLLPRRRGW
FVLSVVLWDAKTMYHVSLLALAVGGAVLDMPLLFAFHVLDIVNQSTELRYISKAIVHPGK
SLAHILILYMLSAYVFGFVGATYFSAYFEKDGHNGCTTLWACFLTSVDEGFKNNGGIGGY
LVPSRRDAGDRLAYPRFVYDMLYYVGLVVILTNVAFGLIIDTFATLRTQHKEKQDDLKDR
CFICSIDCYTFNRMTKGFEHHTRYEHNMWHYIYLFVHVRHKKFTEYNGVELYLATRMAKR
DVTFLPSHRALALEKHHGTSIESGRVPSMASCAAAAIVGRPPHVGCFDGQSAICGTTGEE
GATGVGASSIALQDQLTEMVHGLHAQQQEILALLHKIVATRATASPSTTPRHDRRKSLGP
AKSPMPQQHTRDQST
Download sequence
Identical sequences A0A024TC10
XP_008880167.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]