SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024U5D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024U5D0
Domain Number 1 Region: 2-252
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.63e-72
Family Capz beta-1 subunit 0.000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024U5D0
Sequence length 278
Comment (tr|A0A024U5D0|A0A024U5D0_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW01449.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_06963 OC=Aphanomyces.
Sequence
MSDDGMTTSLNILRRMPPGNVAKDLAGICQLQPDLEDELYQRVDQPLGQAVDPTAGRPFL
LCDYNRDGDSHRSPWTNAYFPPIEDGEGFVPSDNLRQLEIQANELFDVYREMYYQGGVSS
VYMWDLEPGFAACILIKKDVHHQRFVEEGGWNSIHVLEVHEKNDKEAVYTLTSTVLLTMN
VSRRQELGHLNLDANLTRQTERTMKFDSQTAHLSNMGRLVEDMEIDIRSNLDRVYISKTR
EVLNGMRKLQHGVATAQGANPFVGELGRAVLKHGKPSA
Download sequence
Identical sequences A0A024U5D0
XP_008870447.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]