SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024UX56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024UX56
Domain Number 1 Region: 275-401
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000122
Family MIR domain 0.0086
Further Details:      
 
Domain Number 2 Region: 475-608
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000000000105
Family IP3 receptor type 1 binding core, domain 2 0.0025
Further Details:      
 
Domain Number 3 Region: 1124-1239
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000235
Family IP3 receptor type 1 binding core, domain 2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024UX56
Sequence length 2665
Comment (tr|A0A024UX56|A0A024UX56_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW10527.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_00810 OC=Aphanomyces.
Sequence
MATQPAAVGSAGTASRIAEGGHDPRQHCLLFGLPIVLYNQQLPGYVGAEGFGDLRVTLLK
TSRQHVRPADSSSLDSVDVDNELVRHNFNERVFVVVPAQQHAASTALRKYLADHDADPMS
ALESRLRESARLEKRLNDDAVHASCGQVVTYGQSIQLLHVNSSKFVAVRPRMLSDTERDA
MKVELLAEPFEDAHFQIQSPYRHLCPGDEVLLHDDVVFASGTWQVQLHVGYRLSMAQHAA
GGGSDFVEVNGSASGDAFYIQRFAHIDAPTHCLRGGDLVRFLHCRVGTFLSSEGDAVRLC
HQSSDEGGGFHSVQSLWQVQHVDLLNGNEVAVSNVCCIRHVATRQFLVVQDINGCPTCTL
TPHRTSRSHFTLATESFLSGRLLRHDRPLFLQHVTTGGWIGLPPGATDPTAAVVSNAATS
VEKSNAFRLQIIQPSEATESLFLLSLLPQLQGVHDELGRLVHQNGADPHNLRSSTLWIVH
ILDELSRFCIDTRDDRGAPIAARQNVLVEMDCIGLVVRLLQQPFVDWAGPLSMAVFCNAA
DGDAPPSSATSSDLCSSIRTICQHSYKLLVHLVRLNSKTSIVCAAHLGTFGRQVGFDVHA
EALVLELLCSSESLVTAISDNVVTLFVTLLRERGRQADYVDYLTKLCQFKATGIQAKQVA
LCGHLFPTTAATVAEVGILLDVHVTSNHQLTVCHPSTNEWTPIAQLVAADKGLARYFLAT
IRMLSAMCCSRNYIAIHAVEKQFPRDAVVAVVQDSRVHTKMRAAFCRLLAAVYVDRLPHE
VLPRPKRVFVSPTVKMPPGTEASVPNPVSTDRNDADGFFPALKTVLNETLAACQGTLTAS
QSHLLLGMLPLCIQMLSFGCYTDESELKTLVQALVPLLRDHMQTKPIPITSTSPLARLRN
TSLRPTPLPSSIEDRPAAPTTSTSSQTCASGPASTAQIRKASISEQAQTPRKQHSIHKCK
LLLCQILTWTLRLSMDAQLDGIVSWFFTQSFVRTDASGVSPAKVYAELEAKWMANHAAIG
TSCESILCGATLFDRLVHGHDWTAALLTLVASDYPALVSTALDLLGSSFNVHRELRKHLE
HVIVVPSDHAYSMYTNMRVSASVLRLYEETSETWLSMRAGETWKDVLSSLEWFIDVLATT
DDLTQIQELVRGLGVDDLVVNITRSLGNFLVATPRTASNRVFLRRQEHLLDGCYRFFVLY
TWQNTPAQTKLHDHVDFFKHCVSHRHMPVAIFYAIYHNNVALCRALPPWLVPFVVDLIDQ
TGPVAEYVDILSALAVCNGVPMKDNQNAISLQLLASHRKPHVVDSALDLSAVTNDSDGVA
ALDTLLEPPKTDMLRVPRKALFDRDDSVTQGAADRQPSRIHSIQERILSLVGRFATVVGD
DASTRLPTLTAVPFVLTQKATTHGVAQTFGTIEASPRPVLYQAKLLELLANLTLGANFVC
EARLQGLIPLDSLVRALLRKGLPLPLKCKLVKVLHEGWLHTEQFVAEVAGSHTLVQFIAC
QPSILRAMVQRARSSDESHSTSHEALFVLDSLLPMLVHYFRHHCDGEVKHDLVGPLKDLV
DIFSSVVQTTPPRHPWLGNMTAATVDAIHAFVDVASTLLRQPRMALPAPSTSTLAASRGS
GGLSEAQSALKAFAKWLHVAPFYVAAIDRDKRVMLDAFMHTNTADPPRRTTISARLSVVR
VHPTKKGSSAPPGIDAKYLVARLIAHANNSEIRLGQPAHHSTLEILTILEQVSSSNATQA
LVHLLGAPKMMVELGCRAHDHDVATHKALVLLAMSLLRHGGFDAQEQFFALLSMGANVKW
FDRVGKYLRAAIAAVDTRHPSEGQQDLDRNAGTTNLLEMLRLLCEGHHSKFQNLLRHQPC
SHPSVNVVELVVVLFNELVRTLTPTSVPVLLKTFQAIVEFIQGPCEGNQLAVIDPSELHG
GTFLDSINVLLSLSNAEPGFAPGDVHRLKYMCSLALVALVEGRTDTIIHDRMATLLSMRL
LKETLVAVYTSFAKRHEGRYTEAAFDPDLLSAEGRQRDNYVVRLIKITLGQAHIPPADAT
PATSASPSAATSTTERADDTGFPRNPLLGALLPGPTSPPMQFMLNAGFNIYILFHRLLEV
PAVAHILRSSLIPSDGDLRDLEESPLALMNPIVAAFNARRRLQRLSQLVKSDRDVSYVEA
YAFFHRYCASVEVHVGGDKSGDVPVIPGNNLKSATTDGRPRRRLQRFYFPKPPVCAFLTS
DMRNAVMDNINRDSPAEKIQDLFQRSDAIIAEMTHRYLMSFAGDKLFTWGKLLSFGFAIV
LNMLLIACYVDMGDPRFESLALAFQSPDDAYYHIGCVGAIGGVPITSIIRVFGLFQVIVS
VGIVLLYAFTYGPLIMLEGWKRHAGKAKKAVASTSASLLHEAGAPFRSPSSQSIAALGAT
SPSATAYSLTIGGVHFENVRPANIGRSLVFLLLNPVFPELTIIVHAVAWPWKSLVLSFCL
MMIAIYIFAIVGFTYFRHQYPTVASSAANSTDTIAECGMLLSCYLTTFDQTFKNNGGIGS
YMATQTPDDIMNWGPRLVFDNLFNIVILLIIVNIFFGIIIDTFGDQRSRMEARANDIAGK
CFVCSLSRETFDRVAPLGFEHHIRNEHNLWNYVFLVAHLRFKSENEFDGVEQYLWRCIRY
EDYSFVPLYHALALKHDASVKHDSA
Download sequence
Identical sequences A0A024UX56
XP_008861941.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]