SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024WE74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024WE74
Domain Number - Region: 885-997
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00149
Family UbiE/COQ5-like 0.057
Further Details:      
 
Domain Number - Region: 259-311
Classification Level Classification E-value
Superfamily MIR domain 0.0759
Family MIR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024WE74
Sequence length 1211
Comment (tr|A0A024WE74|A0A024WE74_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW39224.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_00059 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNHLFSFQINLNDIFTGDNIKKSENSCDYCIKRKRVCKCDTIKEELGSEHIAILNDLVDL
KKYYDEVCEKIVDKYQDVVHRFEYDKDIVKYIKKHNINDEIECVDWLYFYELLKERKILE
NIINTKEDKDNVTSLNSFHINEEANFISCINYYLKINKYNNVQHNWMGMSLNPFNEYINN
NYNFDIFNKNENIDDINKEKKNDFLNYHSLLKMKNEKEDIYNERKKDDILLYKDKKFYPL
YYYSYILYENEKWISGINNTGNILHLENIEYVWNKTVREGNKIKLFHLITCDCLKIKDIH
NIYMNNKEISKDKIKIIEESIHIERILCISQLVCSLGMINIGGCFIMKIKLSFDNFLLSI
FSILSICFKKVDVYRPSCCYLQNVIFLIGIHFNGITSIFLSCLNNWVQLAQKEIVPLLSC
NDKYNVEDNIGNVKENEQKKIKLNDNILHDNRKEHTMWDYINHSIIPLKWIKSNYLKEYK
NCINHFIEYIIYELKKCINVSNISLIKKNIENTKNTYISQFFEEHKIIDIKKKDKLIYKL
MDHIYEDVNLLNERYHEENKDKINDHKYNNIDNVSISSEDINNETFFNNNINNADNKNWL
KINNSILYETEEKGIYFRNTYYKNNYCNENIKKYRKKITALLKKIKFKNINDINENKKKT
NNYHNNNNNNNKNELFQLDEYIIKKRKFSMDKNLILKHHLEFENLLKKQVYFTNKNWFKS
YLHNNVDKYNNSFFLKKKNTFKDILKCRYYLYYNNYDIHINSFKQILKQYEPLNISYINY
ELHANVIDCLFTLTNCANLNIFQNSLFLQQFIVISNEQNVYNFFSKFQSGHYVYFDAKIQ
SHILSEHGSKKRGADHSETFLNLDDMYENTKSYKAISELLISYIKDKNSCSFIYIDMNSI
YPNFVDVVEKELKIKNYLVGSLIIAYNFLKKNGNMIIRLSSVLTFFTAGLIYILFCSFDK
IEFFVPPSCDDISLDIFLYCHNFNENYIYRHYIQFIWDALICNKHIDEKLFNMDEKKKLD
KPINKKRKADLYFSVPMYYLMNKHFVMFLKKFNSFYFKHHINVCLNFMKEPKYFYHNKIL
IKSLLTHFFKAYVIQGKTFENVYKSIGMSFDNFYEGREDSDDEDEEDDEDEENKKEQEQE
EEEEQEEEKEKTHEAYDEEKSFKAFLHLNRKESHAKNQFEFYSSDSNYSIMCEYKNVPSE
ISISESAWDSS
Download sequence
Identical sequences A0A024VEM1 A0A024WE74 W4IQ30 W4J8H2 W7FKD9 W7FR37 W7K1A9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]