SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WGH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WGH5
Domain Number 1 Region: 11-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000011
Family Ribosomal protein L24e 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WGH5
Sequence length 63
Comment (tr|A0A024WGH5|A0A024WGH5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW46073.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_05862 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSQIKTTVKTEACSFSEYRIYPGRGQKYIARDGKVYFYLSSKFASLALQKKKAAKLRWTQ
VKR
Download sequence
Identical sequences A0A024WGH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]