SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024WLX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WLX4
Domain Number 1 Region: 403-698
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.29e-63
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000107
Further Details:      
 
Domain Number 2 Region: 23-76
Classification Level Classification E-value
Superfamily MIR domain 0.0000000183
Family MIR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WLX4
Sequence length 703
Comment (tr|A0A024WLX4|A0A024WLX4_PLAFA) Seryl-tRNA synthetase, cytoplasmic {ECO:0000313|EMBL:ETW48239.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_03702 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MINNNLFVFFLLSFFLSKICTCLYVTDGSSIILENIGTKYKLFSTDMKWGTGSGNQLVTA
VTTNKNEDDLLWTVSLYEVSSEICSMHLSKIIFLLIILFPYHVNSRKPIKYKNVNNVFIE
IYPCKAIKWERKKKKRDLIKNNKLIHNVDVNYINMITNDNHISSEKCRDIKKKRKITSSE
YGMSLEFFKKNPKKVVQNLKKRGMEKYLNVIVMLKKLINEKNENEVLRNKLRNRRKLLSD
HIKNLIFNSKKYEDIINRDITNDSDHKTNLIHVDEEKKKTEKKNDTQDILKDNQKIRYIN
KENQATNNNINNQDNSNDVLKKNKIQIEEIKKETNQINKDIDHIEMNIINLKKKIEFNLY
KLPNILLNKVPKGKTTEDNKIIKFYKKENIIQLNNEEYDFIEPHEEIIKKYENNFIFSNI
SNKIGFGYNILVNDIAKLERALIDFMINTHVNKFLYTYVKAPEIVTKSALFNTGQLPKFE
EDLFKITDNYKLLNEDAYLIPTSEVSLLNLFKNSQIDYIHLPIKLVSHSSCFRTEKNNTY
GKTSKGLLREHIFQKVELINITDKKTSPFYYKKLIKQSTYILKQLNIPYRLVLLNSIETP
YSASICYDIEAWLPSQQRYVEVSSCSNCLDFQARRLNLKYKIKDSNNFCHTINGSGLAVG
RVLAIILEQYQIKKKHKNEITKIQVPKVLRKYMNKDIIQVEYN
Download sequence
Identical sequences A0A024WLX4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]