SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WQH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024WQH5
Domain Number - Region: 29-87
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0068
Family EspA-like 0.015
Further Details:      
 
Domain Number - Region: 102-149
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0468
Family Intein endonuclease 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WQH5
Sequence length 182
Comment (tr|A0A024WQH5|A0A024WQH5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW48940.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_03078 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKKISLHNILTNKYNVNYIPKKFFSEHTIIDHIRKVKNKLDRGSLYLLQESINNNHQFIK
EEKKVKFQKVINELNNLLTHKSYLMEEKIKILNQHNSKGYKNKEFIGLFLTGFFIAIGSI
SHSIFYLVSVYGIYILHKASKENNSMIYVEKKLNENKNKLLKNKKNVEDLLTLLENDLIT
TK
Download sequence
Identical sequences A0A024V6A1 A0A024W5E6 A0A024WQH5 A0A024X7N0 A0A2I0BQM1 C6S3E3 W4IFT2 W4J377 W7F752 W7FPA4
XP_002585420.1.26446 gi|254922495|gb|ACT83908.1| gi|258549095|ref|XP_002585420.1| PF10_0415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]