SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A026W5X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A026W5X1
Domain Number - Region: 13-49
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00157
Family Ribosomal protein S14 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A026W5X1
Sequence length 56
Comment (tr|A0A026W5X1|A0A026W5X1_OOCBI) 40S ribosomal protein S29 {ECO:0000313|EMBL:EZA51472.1} KW=Complete proteome; Reference proteome OX=2015173 OS=Ooceraea biroi (Clonal raider ant) (Cerapachys biroi). GN=X777_09808 OC=Vespoidea; Formicidae; Dorylinae; Ooceraea.
Sequence
MGFQNIWYSHPRKYGQGSRSCRACANRHGLIRKYGLNICRQCFREYAADIGFKKLD
Download sequence
Identical sequences A0A026W5X1 A0A087ZTD7 A0A151IAS1 A0A158NRI7 D3KCZ2 E2AU87
7460.XP_001120566 Cflo_04240--XP_001120566.1_APIME ENSAPMP00000004807 pbar_RpS29-1 XP_003395523.1.43243 XP_003395752.1.43243 XP_003696202.1.59471 XP_003705193.1.71094 XP_006564279.1.77095 XP_006616532.1.66377 XP_011049791.1.86870 XP_011170782.1.47049 XP_011264033.1.72520 XP_011343318.1.87679 XP_011633747.1.19355 XP_011691029.1.89273 XP_011881099.1.68811 XP_012060145.1.45171 XP_012233944.1.42766 XP_012533386.1.53737 XP_015433304.1.55303 XP_016911782.1.2121 XP_017767676.1.86738 XP_017796042.1.86229 XP_017891754.1.74565 XP_018048832.1.4000 XP_018303201.1.62676 XP_018356707.1.14990 XP_018372525.1.32933 XP_018402609.1.22276 XP_020293741.1.29359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]