SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A026WBI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A026WBI2
Domain Number 1 Region: 242-423
Classification Level Classification E-value
Superfamily MIR domain 7.98e-57
Family MIR domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A026WBI2
Sequence length 664
Comment (tr|A0A026WBI2|A0A026WBI2_OOCBI) Protein O-mannosyl-transferase {ECO:0000313|EMBL:EZA52404.1} KW=Complete proteome; Reference proteome OX=2015173 OS=Ooceraea biroi (Clonal raider ant) (Cerapachys biroi). GN=X777_08547 OC=Vespoidea; Formicidae; Dorylinae; Ooceraea.
Sequence
MGSWYINRTFFFDVHPPLGKMLIALSGYLTGYDGTFAFEKPGDKFEDVKYIGMRIFCTML
GATTVPLAYLIVWDFTKSIRASALSALLVLSDVGLLTLNQYILLDPILLCFIMCATWGMA
RVASLHEQPFTFTWWFWLSFTGAALACTIGVKFVGLFVVLLVGLHTAYELWRELGDLSKP
ISHVGKHLLARCICLILLPVLLYMLFFYIHLSVLNKSGSGDGFYSSEFQSLLRGNSLYNA
TMPRQLAYGATITLKNHRTGGGYLHSHWHLYPEGVGARQQQITTYSHKDDNNLWLVKKFD
TDAIPAEPELVRHGDLVRLEHTITRRNLHSHKEIAPISKKHYQVTGYGENGTGDANDVWK
ILITNGRDGDVVETVTSKLKFVHYLHHCVLTCSGKTLPKWGFSQQEVSCNPNMRDRNALW
NIEDNQYAKLPNVSFRVYAPGFLDRFLESHAVMLQGNSDLKVKEGEVSSRPWQWPIKGGG
GGGGGGGPRLGPQGQFFSGNNQRIYLLGNPIVWWGNIVFLVTFVALYVHASVREQRGYDD
DADNIERRKRLTHAGKWLFLGWLLHYAPFWAMTRVLYFHHYFPALLYSSMLTGITLNHVV
EGLLLSLPDKLGSTFYHVALGSVVSGTAYSFYLFSPLAYGMDGPAAIDPESSMHSLRWME
SWEF
Download sequence
Identical sequences A0A026WBI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]