SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A026WK55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A026WK55
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.96e-32
Family Ribosomal L11/L12e N-terminal domain 0.0000128
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.44e-17
Family Ribosomal protein L11, C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A026WK55
Sequence length 165
Comment (tr|A0A026WK55|A0A026WK55_OOCBI) 60S ribosomal protein L12 {ECO:0000313|EMBL:EZA56353.1} KW=Complete proteome; Reference proteome OX=2015173 OS=Ooceraea biroi (Clonal raider ant) (Cerapachys biroi). GN=X777_02972 OC=Vespoidea; Formicidae; Dorylinae; Ooceraea.
Sequence
MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITV
QLTIQNRQATISVVPSAASLIIKALKEPPRDRKRQKNIKHSGNLSFDDIVSIARSMRPRS
MSRTLAGTVKEILGTCQSVGCTIEGRPPHDLIDDINAGELEVPEE
Download sequence
Identical sequences A0A026WK55
XP_011335603.1.87679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]