SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A026WK90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A026WK90
Domain Number 1 Region: 546-627
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000126
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A026WK90
Sequence length 660
Comment (tr|A0A026WK90|A0A026WK90_OOCBI) Sodium-independent sulfate anion transporter {ECO:0000313|EMBL:EZA56467.1} KW=Complete proteome; Reference proteome OX=2015173 OS=Ooceraea biroi (Clonal raider ant) (Cerapachys biroi). GN=X777_03088 OC=Vespoidea; Formicidae; Dorylinae; Ooceraea.
Sequence
MENRREVRLTGFSSNALDDVLRSNNNEPNAPNSNSSGTIIGAHAITKDAKIVNLDVPQNS
DKNVLCTSGRRWLHRRIRNSCRKKLLFKRIPILAWLPNYRKEYVVSDLVAGITVGLTVIP
QAIAYANVAGLPLQYGLYSSFMACFVYTIFGSWKDVPVGPTAIAAILTRETLQKAHLGPD
FAILLCFISGCVSLLMGILQLGFLLDFISGPVSVGFTSAAAIIIATSQVKDILGLKVAAT
EFVQVWRSIFEHIGETRRWDTALGIACIIVLLLLRKIKDIPVAKNTKEPTQIQQAITKLL
WLISTARNIIIVIVCAVMCWLLEEHLGESPVILTGHVKQGLPEFRLPPFEAQVGNETYTF
VDMISALGTGCLVVPMLSLLETISIAKVFSEGKSIDATQEMLALGLCNVVSSFVSSMPVS
GGLSRGAVNHSSGVKTTLGGVYTGLLVLISLQFLTPYLYYIPKAALAAVIIAAVVFMVEF
QVVKPMWRSKKIDLIPAVVTFLCCLFIRLELGIVIGIGINLLFLLYATARPTLRVHKATS
ISGYEYLVITPDRSLVFPSVEYVRAVISKQGLREGTAVPVVIDSTHIQAADFTAAKGIKT
LIEDFTKRGQPLIFHNLKPSVIEIFKGVKPSGLMCSSSELELNDCLKEYTNISAESLNRY
Download sequence
Identical sequences A0A026WK90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]