SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A028AFS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A028AFS5
Domain Number 1 Region: 29-86
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000276
Family Phage repressors 0.054
Further Details:      
 
Weak hits

Sequence:  A0A028AFS5
Domain Number - Region: 115-185
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.0379
Family Methylesterase CheB, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A028AFS5
Sequence length 203
Comment (tr|A0A028AFS5|A0A028AFS5_ECOLX) Transcriptional regulator {ECO:0000313|EMBL:EZE09735.1} KW=Complete proteome OX=1446753 OS=Escherichia coli O69:H11 str. 08-4661. GN=BX06_14320 OC=Enterobacteriaceae; Escherichia.
Sequence
MDKAEKTVSSAERFIDMEGINRFSERLAMAMGNMTNVELATLCGLSEATVRNYRKGKNFP
PLDKLALIAKACNCSLEWLATGKNEDECGKIENNCDSGSGIDQALSSLSPQEKQLILTFI
RREGTNNLVRLAAMNTSTISQDAVESIIDALPLRPVLKNAIKIGMAGSEETDKEILRVIE
KYNSSNNATQESGAVTVKKNVVG
Download sequence
Identical sequences A0A028AFS5 A0A0F3UUW2 K4X5D9
WP_000356295.1.100073 WP_000356295.1.100315 WP_000356295.1.10086 WP_000356295.1.10508 WP_000356295.1.10651 WP_000356295.1.13936 WP_000356295.1.142 WP_000356295.1.14693 WP_000356295.1.16075 WP_000356295.1.18438 WP_000356295.1.20025 WP_000356295.1.20334 WP_000356295.1.23593 WP_000356295.1.24070 WP_000356295.1.2456 WP_000356295.1.25613 WP_000356295.1.26474 WP_000356295.1.29082 WP_000356295.1.31518 WP_000356295.1.31899 WP_000356295.1.32995 WP_000356295.1.35393 WP_000356295.1.389 WP_000356295.1.40249 WP_000356295.1.41479 WP_000356295.1.41734 WP_000356295.1.43816 WP_000356295.1.45600 WP_000356295.1.47319 WP_000356295.1.50762 WP_000356295.1.51505 WP_000356295.1.53251 WP_000356295.1.53537 WP_000356295.1.54213 WP_000356295.1.5440 WP_000356295.1.55988 WP_000356295.1.56835 WP_000356295.1.57032 WP_000356295.1.57659 WP_000356295.1.60043 WP_000356295.1.60599 WP_000356295.1.60771 WP_000356295.1.65954 WP_000356295.1.68096 WP_000356295.1.68961 WP_000356295.1.72322 WP_000356295.1.73934 WP_000356295.1.74431 WP_000356295.1.76009 WP_000356295.1.76595 WP_000356295.1.80484 WP_000356295.1.81160 WP_000356295.1.83099 WP_000356295.1.8477 WP_000356295.1.84797 WP_000356295.1.85342 WP_000356295.1.85558 WP_000356295.1.85762 WP_000356295.1.86574 WP_000356295.1.90856 WP_000356295.1.91384 WP_000356295.1.92195 WP_000356295.1.94343 WP_000356295.1.94676 WP_000356295.1.95800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]