SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031FSF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031FSF5
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily Barstar-related 0.000000419
Family Barstar-related 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A031FSF5
Sequence length 129
Comment (tr|A0A031FSF5|A0A031FSF5_9MICO) Acyl-CoA dehydrogenase {ECO:0000313|EMBL:EZP27769.1} KW=Complete proteome; Reference proteome OX=273677 OS=Microbacterium oleivorans. GN=BW34_01761 OC=Microbacterium.
Sequence
MAEYVIEGSRIDGIPDLYEELNRLFMTGEDWQLGASLDALDDLLYGGYGVHSQDAAVRVV
WRDAAHSREALGIAETERWLRGKLAQPGTFHATGIRNQLDEMLAGTGKTYFELVLEVFAD
HPEVTLELG
Download sequence
Identical sequences A0A031FSF5
WP_036311390.1.61544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]