SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031FSM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031FSM2
Domain Number 1 Region: 81-110
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000128
Family Prokaryotic DksA/TraR C4-type zinc finger 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A031FSM2
Sequence length 112
Comment (tr|A0A031FSM2|A0A031FSM2_9MICO) DnaK suppressor protein {ECO:0000313|EMBL:EZP27593.1} KW=Complete proteome; Reference proteome OX=273677 OS=Microbacterium oleivorans. GN=BW34_01582 OC=Microbacterium.
Sequence
MDAVDRLRARELELRAQLSRLDADDAALRVDRSDATADDEHDPEGSTLSGEWQRVDALRA
STRDELAQVATALARVDAGTYGVCERCGREIPAARMEVRPQATMCVACASVG
Download sequence
Identical sequences A0A031FSM2
WP_036311059.1.51374 WP_036311059.1.61544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]