SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031FWU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031FWU2
Domain Number 1 Region: 4-119
Classification Level Classification E-value
Superfamily HisI-like 1.83e-49
Family HisI-like 0.0000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A031FWU2
Sequence length 133
Comment (tr|A0A031FWU2|A0A031FWU2_9PSED) Phosphoribosyl-AMP cyclohydrolase {ECO:0000256|HAMAP-Rule:MF_01021, ECO:0000256|SAAS:SAAS00976554} KW=Complete proteome OX=1470589 OS=Pseudomonas sp. RIT288. GN=BW33_04094 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKNWLDEIKWDADGLVPAIAQDHKTGRVLMMAWMNREALELTAAENRAIYWSRSRGKLWR
KGEESGHVQTLHEMRLDCDADVIILMVEQIGDIACHTGRQSCFYRVYENGDWKTVDPVLK
DPHAIYSAGHKHE
Download sequence
Identical sequences A0A031FWU2 A0A285G9R3 A0A2C5WD04 K0W9V6 W6VIR6
fid|94010726|locus|VBIPseFlu147482_0369| WP_003220851.1.1485 WP_003220851.1.25625 WP_003220851.1.32813 WP_003220851.1.94451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]